Haus Produkte

Wachstum Hormon Peptide

Gute Qualität Bodybuilding Steroide en ventes
Gute Qualität Bodybuilding Steroide en ventes
haben mit biopro für Jahre zusammengearbeitet und ich wurde eingeladen, etwas hier zu sagen. der meiste Berufsverpackungs-, hochwertigste und besteservice!

—— Alexander Gaus

Biopro ist!!!! ehrfürchtig! Mein Vertreter ist sehr höflich und hält mich gegenwärtig mit neuen Förderungen. Ihre Pulver, die ich bestellte, geben mir sehr gutes Ergebnis!

—— Oleg M

Sie Kerle sind soooo schnelle Kommunikation und gute Qualität. erhält bestimmt zurück mit mehr Aufträgen.

—— Susan Rustiguel

Ich bestelle mit biopro für eine lange Zeit und kann sagen, dass sie leichterer und aufmerksamerer Verkäufer sind, den Sie machen können einen Auftrag.

—— Stechpalme Shane

Die Qualität ist sooo Stall, während Auftrag von Ihren Kerlen diese Jahre, es erstaunliche Qualität ist, ich ändert nie meine Quelle Lattich, den sie mir gutes Feed-back! holt!

—— Alex Clinton

Ich bin online Chat Jetzt

Wachstum Hormon Peptide

(98)
China 1Mg/Phiolen-Bodybuilding-Wachstums-Peptide Follistatin -344/Follistatin -315/Ace -031 usine

1Mg/Phiolen-Bodybuilding-Wachstums-Peptide Follistatin -344/Follistatin -315/Ace -031

1Mg/Phiolen-Bodybuilding-Wachstums-Peptide Follistatin -344/Follistatin -315/Ace -031 Follistatin (FST) ist ein abgesondertes Glucoproteid, das zuerst als Follikelstimulierungshormonhemmstoff in der Eierstock ... Read More
2017-04-11 14:24:46
China Peptid-Pulver-Mager-Körper-Masse CJC -1295 DAC 5mg/Phiole, 2mg/Phiole der Reinheits-99% rohe usine

Peptid-Pulver-Mager-Körper-Masse CJC -1295 DAC 5mg/Phiole, 2mg/Phiole der Reinheits-99% rohe

Peptid-Pulver-Mager-Körper-Masse CJC -1295 DAC 5mg/Phiole, 2mg/Phiole der Reinheits-99% rohe Grundlegende Details: Produkt-Name: CJC1295 DAC Alias: CJC1295 mit DAC Dichte: 1,45 Art: Immunfunktion AgentsGrade ... Read More
2017-04-11 14:24:14
China Wachstums-Hormon-Peptid-Energie CASs 86168-78-7, die Sermorelin erhöht usine

Wachstums-Hormon-Peptid-Energie CASs 86168-78-7, die Sermorelin erhöht

Wachstums-Hormon-Peptid-Energie CASs 86168-78-7, die Sermorelin erhöht 1. Schnelle Details: Produktname: Sermorelin Reihenfolge: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg... Read More
2017-04-11 14:23:35
China Gmp-Laborversorgungs-Muskel-Wachstums-Hormon-Peptide langes R3 IGF -1/IGF -1 LR3 usine

Gmp-Laborversorgungs-Muskel-Wachstums-Hormon-Peptide langes R3 IGF -1/IGF -1 LR3

Gmp-Laborversorgungs-Muskel-Wachstums-Hormon-Peptide langes R3 IGF -1/IGF -1 LR3 Produktinformation: Produktname: IGF-1 LR3 CAS Nr.: 946870-92-4 Reinheit: .98%min Auftritt: Weißes Pulver Lagerung: Trockener k... Read More
2017-04-11 14:22:53
China Fragment 176-191 CAS 221231-10-3 der Bodybuilding-Wachstums-Hormon-Peptid-HGH usine

Fragment 176-191 CAS 221231-10-3 der Bodybuilding-Wachstums-Hormon-Peptid-HGH

Fragment 176-191 CAS 221231-10-3 der Bodybuilding-Wachstums-Hormon-Peptid-HGH Beschreibung Was ist (HGH)-Fragment 176-191 des menschlichen Wachstumshormons? HGH-FRAGMENT 176-191 ist ein generisches Steroid und ... Read More
2017-04-11 14:22:19
China CJC -1295 DAC rohes menschliche Wachstums-Steroide des Peptid-Pulver-fettes Verlust-CJC -1295 mit DAC usine

CJC -1295 DAC rohes menschliche Wachstums-Steroide des Peptid-Pulver-fettes Verlust-CJC -1295 mit DAC

CJC-1295 DAC rohes menschliche Wachstums-Steroide des Peptid-Pulver-fettes Verlust-CJC -1295 mit DAC BeschreibungCJC-1295 DAC als Wachstumshormon, das Hormon (GHRH)-Entsprechung freigibt. Hat Wachstumsnicht nur ... Read More
2017-04-11 14:21:30
China Gmp-Körper-Schutz-Mittel-Muskel-Wachstums-Hormon-Peptide IGF -1 DES 1mg/Phiole usine

Gmp-Körper-Schutz-Mittel-Muskel-Wachstums-Hormon-Peptide IGF -1 DES 1mg/Phiole

Gmp-Körper-Schutz-Mittel-Muskel-Wachstums-Hormon-Peptide IGF -1 DES 1mg/Phiole Basisdaten. Reihenfolge: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Molare Masse: 7.372 DA Synonyme: IGF... Read More
2017-04-11 14:20:51
China 99,5% Reinheits-Peptid-rohes Pulver TB-500 für Muskel-Verletzungs-Behandlung 2mg/vial, 5mg/vial usine

99,5% Reinheits-Peptid-rohes Pulver TB-500 für Muskel-Verletzungs-Behandlung 2mg/vial, 5mg/vial

99,5% Reinheits-Peptid-rohes Pulver TB-500 für Muskel-Verletzungs-Behandlung 2mg/vial, 5mg/vial Beschreibung TB-500 ist ein Peptidfragmenthormon, das hauptsächlich in der Behandlung von den verschiedenen ... Read More
2017-04-11 14:20:09
China Männliche/weibliche HGH-Peptide Bremelanotide Pint -141 10mg/Phiole CAS 189691-06-3 usine

Männliche/weibliche HGH-Peptide Bremelanotide Pint -141 10mg/Phiole CAS 189691-06-3

Männliche/weibliche HGH-Peptide Bremelanotide Pint -141 10mg/Phiole CAS 189691-06-3 Beschreibung PT-141 (Bremelanotide) wurde vom Peptidhormon melanotan II entwickelt, das Prüfung als sonnenloser Gerbstoff ... Read More
2017-04-11 14:17:42
China Gesunde Peptide GHRP-2 des menschlichen Wachstumshormons für fetten Verlust 5mg/Phiole, CAS158861-67-7 usine

Gesunde Peptide GHRP-2 des menschlichen Wachstumshormons für fetten Verlust 5mg/Phiole, CAS158861-67-7

Gesunde Peptide GHRP-2 des menschlichen Wachstumshormons für fetten Verlust 5mg/Phiole, CAS158861-67-7 Beschreibung: GHRP-2 (alias KP 102 oder Pralmorelin) ist ein synthetisches hexapeptide Wachstums-Hormon, ... Read More
2017-03-31 14:08:43
Page 1 of 10|< 1 2 3 4 5 6 7 8 9 10 >|