Startseite ProdukteWachstum Hormon Peptide

Gmp-Körper-Schutz-Mittel-Muskel-Wachstums-Hormon-Peptide IGF -1 DES 1mg/Phiole

Gute Qualität Bodybuilding Steroide en ventes
Gute Qualität Bodybuilding Steroide en ventes
haben mit biopro für Jahre zusammengearbeitet und ich wurde eingeladen, etwas hier zu sagen. der meiste Berufsverpackungs-, hochwertigste und besteservice!

—— Alexander Gaus

Biopro ist!!!! ehrfürchtig! Mein Vertreter ist sehr höflich und hält mich gegenwärtig mit neuen Förderungen. Ihre Pulver, die ich bestellte, geben mir sehr gutes Ergebnis!

—— Oleg M

Sie Kerle sind soooo schnelle Kommunikation und gute Qualität. erhält bestimmt zurück mit mehr Aufträgen.

—— Susan Rustiguel

Ich bestelle mit biopro für eine lange Zeit und kann sagen, dass sie leichterer und aufmerksamerer Verkäufer sind, den Sie machen können einen Auftrag.

—— Stechpalme Shane

Die Qualität ist sooo Stall, während Auftrag von Ihren Kerlen diese Jahre, es erstaunliche Qualität ist, ich ändert nie meine Quelle Lattich, den sie mir gutes Feed-back! holt!

—— Alex Clinton

Ich bin online Chat Jetzt

Gmp-Körper-Schutz-Mittel-Muskel-Wachstums-Hormon-Peptide IGF -1 DES 1mg/Phiole

China Gmp-Körper-Schutz-Mittel-Muskel-Wachstums-Hormon-Peptide IGF -1 DES 1mg/Phiole fournisseur
Gmp-Körper-Schutz-Mittel-Muskel-Wachstums-Hormon-Peptide IGF -1 DES 1mg/Phiole fournisseur Gmp-Körper-Schutz-Mittel-Muskel-Wachstums-Hormon-Peptide IGF -1 DES 1mg/Phiole fournisseur

Großes Bild :  Gmp-Körper-Schutz-Mittel-Muskel-Wachstums-Hormon-Peptide IGF -1 DES 1mg/Phiole

Produktdetails:

Herkunftsort: China
Markenname: Biopro
Zertifizierung: GMP,SGS,BV,ISO
Modellnummer: GHP-37

Zahlung und Versand AGB:

Min Bestellmenge: Verhandlung
Preis: Negotiation
Verpackung Informationen: 1 mg/vial, 10 Phiolen/Kasten
Lieferzeit: Innerhalb 24 Stunden nach Zahlung
Zahlungsbedingungen: Western Union, Moneygram, T/T
Versorgungsmaterial-Fähigkeit: Masse auf Lager
Contact Now
Ausführliche Produkt-Beschreibung
Produktname: DES IGF-1 Synonyme: IGF-1Des (1-3), Des1-3, DES 1-3, DES (1-3)
Aussehen: Weiß lyophilisiertes Pulver Reinheit: 99% min
Spezifikation: 1 mg/vial Geeignet für: Erwachsener, bodybuildend
Freie Probe: Ja Zollpassierscheinrate: Garantiert

Gmp-Körper-Schutz-Mittel-Muskel-Wachstums-Hormon-Peptide IGF -1 DES 1mg/Phiole

Basisdaten.
Reihenfolge: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molare Masse: 7.372 DA
Synonyme: IGF-1Des (1-3), Des1-3, DES 1-3, DES (1-3)
Mittel: Thr-Leu-Cys-Gly-Ala.
Reinheit: 99,21%

IGF-1DES Dosis
DES IGF-1 kann zu den mehrfachen Zeiten 50-150mcg ein Tag (vor Training) in spezifische Zielregionen dosiert werden. da DES solch eine kurze Halbwertszeit (20-30 Minuten) hat, wurde Desensitization nicht überhaupt bemerkt. Injektionsstellen sollten lokalisiert werden; vorzugsweise an der Muskelgruppe möchten Sie wachsen. In den einfachen Ausdrücken wenn Sie Ihr Bizeps wachsen möchten, spritzen Sie IGF-1DES nach rechts in Ihr Bizeps ein.

IGF-1DES Halbwertszeit
DES IGF-1 ist die kürzere Version der Kette IGF-1. Es ist fünf (5)mal stärker, als IGF-1LR3 und zehn (10) Zeit stärkere als regelmäßige Basis IGF-1 festsetzt. Die Halbwertszeit für DES ist ungefähr 20-30 Minuten, das bedeutet, dass dieses eine sehr empfindliche Kette ist. Deshalb sollte Verwaltung am Standort nur erfolgt sein, in dem Sie Muskelwachstum sehen möchten. DES hat die Fähigkeit, die Muskelhyperplasie anzuregen, die besser als LR3 ist. In den einfachen Ausdrücken wird es gut für Standorteinspritzungen, eher als insgesamt Wachstum verwendet.
Darüber hinaus bekannt DES, um an Empfänger zu binden, die durch Milchsäure verformt worden sind, die häufig während der Trainings anwesend ist. Dieses lässt das DES sich zu einem veränderten Empfänger- und Signalgewebewachstum während des Trainings befestigen. DES kann länger und häufiger benutzt werden als LR3.

Bester Verkauf

Name SPE
Melanotan I 10mg/vial, 10vial/box
Melanotan II 10mg/vial, 10vial/box
CJC 1295 2mg/vial, 10vial/box
dac cjc1295 2mg/vial, 10vial/box
Sermorelin 2mg/vial, 10vial/box
Sermorelin 5mg/vial, 10vial/box
Pint 141 10mg/vial, 10vial/box
Ipamorelin 2mg/vial, 10vial/box
Ipamorelin 5mg/vial, 10vial/box
MGF 2mg/vial, 10vial/box
KLAMMER-MGF 2mg/vial, 10vial/box
GHRP-6 5mg/vial, 10vial/box
GHRP-2 5mg/vial, 10vial/box
Hexarelin 2mg/vial, 10vial/box
Hexarelin 5mg/vial, 10vial/box
Thymosin Beta4 (TB4) (TB-500) 2mg/vial, 10vial/box
Follistatin 344 1mg/vial, 10vial/box
Oxytocin 2mg 2mg/vial, 10vial/box
epitalon 10mg/vial, 10vial/box
DSIP 2mg/vial, 10vial/box
DSIP 5mg/vial, 10vial/box
selank 2mg/vial, 10vial/box
selank 5mg/vial, 10vial/box
BPC 157 2mg/vial, 10vial/box
Gonadorelin 2mg/vial, 10vial/box
Triptorelin GNRH 2mg/vial, 10vial/box
ghrh 2mg/vial, 10vial/box
Tesamorelin 2mg/vial, 10vial/box
ACE031 1mg/vial, 10vial/box
GDF-8 1mg/vial, 10vial/box

Sicheres Verschiffen
Fabrik-Versorgungs-Peptide Igf-1des Igf-1lr3 für Muskel-Gebäude

Anderes Steroid-Hormon-Pulver:
Testosteron-Azetat Trenbolone-Azetat MGF
Testosteron Cypionate Trenbolone Enanthate KLAMMER-MGF
Testosteron Decanoate Boldenone-Azetat CJC-1295
Testosteron Enanthate Boldenone-undecylenate CJC-1295 DAC
Testosteron Isocaproate Boldenone Cypionate PT-141
Testosteron Phenylpropionate Boldenone-Propionat Melanotan-1
Testosteron-Propionat Nandrolone Decanoate Melanotan-2
Testosteron Undecanoate Nandrolone phenylpropionate GHRP-2
Mesterone Nandrolone undecylate GHRP-6
Testosteron Sustanon 250 Nandrolone cypionate Ipamorelin
Clostebol-Azetat Nandrolonepropionat Hexarelin
Methylandrostanolone Methyltrienolone Sermorelin
Methenolone Enanthate Drostanolone-Propionat Oxytocin
Methenolone-Azetat Drostanolone Enanthate TB500
Anadrol Stanolone Fragment 176-191
Anavar Tadalafil Triptorelin
Winstrol Vardenafil Tesamorelin
Clomifene-Zitrat Dianabol Gonadorelin
Toremifene-Zitrat Tamoxifen-Zitrat DSIP
Finasteride Dapoxetine-Hydrochlorid Selank


Halb fertige injizierbare/Mundsteroide:
Prüfen Sie Stütze-----------100mg/ml 200mg/ml
Prüfen Sie enan-----------250mg/ml 300mg/ml 400mg/ml 500mg/ml 600mg/ml
Prüfen Sie CYP------------200mg/ml 250mg/ml 300mg/ml
Prüfen Sie Sustanon-------200mg/ml 250mg/ml 300mg/ml 400mg/ml
Deca----------------200mg/ml 250mg/ml
Equipoise-----------200mg/ml 300mg/ml
Tren-As------------100mg/ml 200mg/ml
Tren enan-----------100mg/ml 200mg/ml
Dianabol------------50mg/ml
Winstrol------------50mg/ml
Masteron------------100mg/ml 150mg/ml
Primobolone---------100mg/ml
Supertest-----------450mg/ml
Anomass ------------400mg/ml
Ripex---------------225mg/ml
Tritren-------------180mg/ml
Tri Test------------300mg/ml
Tri Deca------------300mg/ml
Prüfen Sie Mischung----------450mg/ml 500mg/ml
Nandro-Test---------225mg/ml
Masse----------------500mg/ml
Schneiden Sie Depot-----------400mg/ml
Tren-Test-----------225mg/ml
Nandro-Test-Depot---------450mg/ml
Equi-Test-----------------450mg/ml
Riss-Schnitt-------------------175mg/ml
Tren-Test-Depot-----------450mg/ml

 

Peptide
HGH 176-191 2mg/vial 10vials/kit 1g/bag
GHRP-2 5mg/vial 10vials/kit 1g/bag
GHRP-2 10mg/vial 10vials/kit 1g/bag
GHRP-6 5mg/vial 10vials/kit 1g/bag
GHRP-6 10mg/vial 10vials/kit 1g/bag
MGF 2mg/vial 10vials/kit 1g/bag
KLAMMER-MGF 2mg/vial 10vials/kit 1g/bag
CJC-1295 mit DAC 2mg/vial 10vials/kit 1g/bag
CJC-1295 ohne DAC 2mg/vial 10vials/kit 1g/bag
PT-141 10mg/vial 10vials/kit 1g/bag
Melanotan-1 10mg/vial 10vials/kit 1g/bag
Melanotan-2 10mg/vial 10vials/kit 1g/bag
Ipamorelin 2mg/vial 10vials/kit 1g/bag
Hexarelin 2mg/vial 10vials/kit 1g/bag
Sermorelin 2mg/vial 10vials/kit 1g/bag
Oxytocin 2mg/vial 10vials/kit 1g/bag
TB500 2mg/vial 10vials/kit 1g/bag
Pentadecapeptide BPC 157 2mg/vial 10vials/kit 1g/bag
Triptorelin 2mg/vial 10vials/kit 1g/bag
Gonadorelin 2mg/vial 10vials/kit 1g/bag
Gonadorelin 10mg/vial 10vials/kit 1g/bag
Tesamorelin 2mg/vial 10vials/kit 1g/bag
DSIP 2mg/vial 10vials/kit 1g/bag
Selank 5mg/vial 10vials/kit 1g/bag

 

Wettbewerbsvorteile

1 hohe Qualität mit konkurrenzfähigem Preis
1) Standard: Unternehmens-Standard
2) Alles Purity≥98%
3) Hersteller kann Produkte der hohen Qualität mit Fabrikpreis versehen.


2 schnelle und sichere Lieferung
1) Genügendes stock&disciplined verpackendes Team, zum sich der sofortigen und diskreten Lieferung zu vergewissern;
2) Erfahrenes und professionelles logistisches Mittel kann verschiedene Transportweisen zur Verfügung stellen;
3) Paket kann in 24 Stunden nach Zahlung ausgesendet werden. Spurhaltungszahl verfügbar;
4) Zollpassierscheinrate ≥99%;

Kundendienst 3
Alle mögliche Fragen oder Probleme, nachdem sie das Produkt empfangen haben, fühlen bitte sich frei, mit uns in Verbindung zu treten. Probleme würden sofort gelöst.

 

Wenn Sie an unseren Produkten interessiert sind oder wenn Sie irgendwelche Fragen haben, fühlen Sie bitte sich frei, mit mir in Verbindung zu treten, antworte ich Ihnen bald zur Zeit.

Ansprechpartner Tina
E-Mail tina@bioproco.com

 
 
 

 
 

Kontaktdaten
Biopro Chemicals Co., Ltd.

Ansprechpartner: Tina

Senden Sie Ihre Anfrage direkt an uns (0 / 3000)